PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1BL_4D9406708.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 258aa    MW: 29898 Da    PI: 10.1331
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1BL_4D9406708.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.8e-172369148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g WT+eEd +lv++v+q+G + W+  a++++  R +kqc++rw+++l
  Traes_1BL_4D9406708.1 23 KGQWTPEEDRKLVKLVEQFGLRKWSQMAQMLP-ARVGKQCRERWHNHL 69
                           799*****************************.*************97 PP

2Myb_DNA-binding50.35.4e-1675117145
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                            ++ W++eEd  l++ +k+ G++ W+ Ia++++ gRt++++k++w+
  Traes_1BL_4D9406708.1  75 KDTWSEEEDMVLIQTHKEVGNK-WTEIAKRLP-GRTENSIKNHWN 117
                            679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.5511873IPR017930Myb domain
SuperFamilySSF466893.33E-3120116IPR009057Homeodomain-like
SMARTSM007172.1E-142271IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.5E-292476IPR009057Homeodomain-like
PfamPF139211.4E-192684No hitNo description
CDDcd001672.93E-142669No hitNo description
SMARTSM007174.5E-1574122IPR001005SANT/Myb domain
PROSITE profilePS5129420.22474124IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.6E-2277122IPR009057Homeodomain-like
CDDcd001671.00E-1177120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MSGRFIPRRK ASSKAVKKAN VVKGQWTPEE DRKLVKLVEQ FGLRKWSQMA QMLPARVGKQ  60
CRERWHNHLR PNIKKDTWSE EEDMVLIQTH KEVGNKWTEI AKRLPGRTEN SIKNHWNATK  120
RRQFARRRTR SRAKNPKSGT LLQNYIKSLG IGSSKVIVPL DPKEPPLSAS SPATPTQNRA  180
HMNDNWPESN PSNIMLTQGI FSTDKRQIHS CEEILVPTSD DFSVDMCDGL FNAEEVQYQA  240
YNIDDDVHMD YIIYHIDY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-44211242105MYB PROTO-ONCOGENE PROTEIN
1mse_C6e-44211242105C-Myb DNA-Binding Domain
1msf_C6e-44211242105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010228004.11e-130PREDICTED: transcription factor MYB46-like
SwissprotQ9S7L23e-70MYB98_ARATH; Transcription factor MYB98
TrEMBLW5A1T80.0W5A1T8_WHEAT; Uncharacterized protein
STRINGLOC_Os06g06740.11e-120(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28063788
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.12e-59myb domain protein 98
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]